Modomics - A Database of RNA Modifications

ID Card:

Full name: Fibrillarin-like rRNA/tRNA 2′-O-methyltransferase
Synonym: aFib, Fibrillarin-like
UniProt: D4GZN3
Complex: C/D RNP
Enzyme type:
Position of modification - modification: t:None - Cm
t:None - Um
Level of experimental evidence: 5
Level of experimental reliability: 5



Protein sequence:

MSDDGSAADAALPDGVERRTFGGRERLSTRGEPVYGEPVDSDGWRAWDAGRSKLGAMLELGMDTGLVGGESVLYLGAASGTTVSHVADFAGPTYAVEFAPRPVRDLVGVAEDRDNLFPLLKDARDPDSYAHVVEAGIDCLVMDVATRGQATVAVRNRQFLADDGRLLMAVKARSEDVTAEPDDVFDDVIAELDSAYELLETARLDRFHADHLGIVARPK

Comments:

Involved in pre-rRNA and tRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in rRNA and tRNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
C:Cm tRNA (t) tRNA/tRNA/prokaryotic cytosol 34
U:Um tRNA (t) tRNA/tRNA/prokaryotic cytosol 39



Publications:

Title Authors Journal Details PubMed Id DOI
RNomics and Modomics in the halophilic archaea Haloferax volcanii: identification of RNA modification genes. Grosjean H; Gaspin C; Marck C; Decatur WA; de Crécy-Lagard V BMC Genomics [details] 18844986 10.1186/1471-2164-9-470