| Full name: | tRNA (cytidine(56)-2'-O)-methyltransferase |
|---|---|
| Synonym: | HVO_1173 |
| UniProt: | D4GWS4 |
| Enzyme type: | |
| Position of modification - modification: |
t:None - Cm |
| Level of experimental evidence: | 5 |
| Level of experimental reliability: | 5 |
MHNEPEVAVLRYGHRPGRDDRMTTHVGLTARALGADRVILPDNAGHSMETVEDITGRFGGPFEVELTEALNGVIRNWEGRVVHLTMYGERVQDVEADIREAHAEEPLLVVVGGEKVPFEVYEGADWNVGVTNQPHSEVAGLAVFLDRLFDGRELDREWEDAENRVVPMATGKKVVPADEE
All tRNA types
| Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
|---|---|---|---|---|---|---|---|---|---|---|
| C:Cm | tRNA (t) | tRNA/tRNA/prokaryotic cytosol | 56 |
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| RNomics and Modomics in the halophilic archaea Haloferax volcanii: identification of RNA modification genes. | Grosjean H; Gaspin C; Marck C; Decatur WA; de Crécy-Lagard V | BMC Genomics | [details] | 18844986 | 10.1186/1471-2164-9-470 |