Title: | Complex structure of tRNA methyltransferase Trm1 from Aquifex aeolicus with sinefungin |
---|---|
Classification: | TRANSFERASE |
Technique: | X-Ray Diffraction |
Resolution: | 2.16 |
R value free: | 0.219 |
R value observed: | 0.187 |
R value work: | 0.186 |
Pdb Files | 3AXS.pdb 3AXT.pdb |
Pdbx/mmCIF Files | 3AXS.cif 3AXT.cif |
MEIVQEGIAKIIVPEIPKTVSSDMPVFYNPRMRVNRDLAVLGLEYLCKKLGRPVKVADPLSASGIRAIRFLLETSCVEKAYANDISSKAIEIMKENFKLNNIPEDRYEIHGMEANFFLRKEWGFGFDYVDLDPFGTPVPFIESVALSMKRGGILSLTATDTAPLSGTYPKTCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPIFAYSHLHYFKLFFVKERGVEKVDKLIEQFGYIQYCFNCMNREVVTDLYKFKEKCPHCGSKFHIGGPLWIGKLWDEEFTNFLYEEAQKREEIEKETKRILKLIKEESQLQTVGFYVLSKLAEKVKLPAQPPIRIAVKFFNGVRTHFVGDGFRTNLSFEEVMKKMEELKEKQKEFLEKKKQG
Activity tested in vitro and detected in cell extract.
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|
Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
---|---|---|---|---|---|---|---|---|---|---|
G:m2G | RNA | tRNA | 26 | ACG | ACG | tRNAArgACG | D-loop | Prokaryotic Cytosol | ||
G:m2G | RNA | tRNA | 26 | ACG | ACG | tRNAArgACG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | GUC | GUC | tRNAAspGUC | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | GCC | GCC | tRNAGlyGCC | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | GUG | GUG | tRNAHysGUG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | CGG | CGG | tRNAProCGG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | CAU | CAU | tRNAMetfCAU | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | GCA | GCA | tRNACysGCA | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | CAG | CAG | tRNALeuCAG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | UUC | UUC | tRNAGluUUC | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | GUA | GUA | tRNATyrGUA | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 26 | UUG | UUG | tRNAGlnUUG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | ACG | ACG | tRNAArgACG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | GUC | GUC | tRNAAspGUC | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | GCC | GCC | tRNAGlyGCC | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | GUG | GUG | tRNAHysGUG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | CGG | CGG | tRNAProCGG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | CAU | CAU | tRNAMetfCAU | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | GCA | GCA | tRNACysGCA | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | CAG | CAG | tRNALeuCAG | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | UUC | UUC | tRNAGluUUC | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | GUA | GUA | tRNATyrGUA | D-loop | Prokaryotic Cytosol | 19491098 | |
G:m2G | RNA | tRNA | 27 | UUG | UUG | tRNAGlnUUG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | ACG | ACG | tRNAArgACG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | GUC | GUC | tRNAAspGUC | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | GCC | GCC | tRNAGlyGCC | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | GUG | GUG | tRNAHysGUG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | CGG | CGG | tRNAProCGG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | CAU | CAU | tRNAMetfCAU | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | GCA | GCA | tRNACysGCA | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | CAG | CAG | tRNALeuCAG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | UUC | UUC | tRNAGluUUC | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | GUA | GUA | tRNATyrGUA | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 26 | UUG | UUG | tRNAGlnUUG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | ACG | ACG | tRNAArgACG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | GUC | GUC | tRNAAspGUC | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | GCC | GCC | tRNAGlyGCC | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | GUG | GUG | tRNAHysGUG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | CGG | CGG | tRNAProCGG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | CAU | CAU | tRNAMetfCAU | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | GCA | GCA | tRNACysGCA | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | CAG | CAG | tRNALeuCAG | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | UUC | UUC | tRNAGluUUC | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | GUA | GUA | tRNATyrGUA | D-loop | Prokaryotic Cytosol | 19491098 | |
m2G:m2,2G | RNA | tRNA | 27 | UUG | UUG | tRNAGlnUUG | D-loop | Prokaryotic Cytosol | 19491098 |
Reaction |
---|
Title | Authors | Journal | Details |
---|
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Aquifex aeolicus Trm1[tRNA (m2(2)G26) methyltransferase] has a novel recognition mechanism of the substrate RNA. | Awai T, Takehara T, Takeda H, Hori H | Nucleic Acids Symp Ser (Oxf) | [details] | 17150754 | - |
Aquifex aeolicus tRNA (N2,N2-guanine)-dimethyltransferase (Trm1) catalyzes transfer of methyl groups not only to guanine 26 but also to guanine 27 in tRNA. | Awai T, Kimura S, Tomikawa C, Ochi A, Ihsanawati, Bessho Y, Yokoyama S, Ohno S, Nishikawa K, Yokogawa T, Suzuki T, Hori H | J Biol Chem | [details] | 19491098 | - |
Identification of Aquifex aeolicus tRNA (m2(2G26) methyltransferase gene. | Takeda H, Hori H, Endo Y | Nucleic Acids Res Suppl. | [details] | 12903189 | - |
Substrate tRNA recognition mechanism of a multisite-specific tRNA methyltransferase, Aquifex aeolicus Trm1, based on the X-ray crystal structure. | Awai T, Ochi A, Ihsanawati, Sengoku T, Hirata A, Bessho Y, Yokoyama S, Hori H | J Biol Chem | [details] | 21844194 | - |
Title |
---|
Aquifex aeolicus Trm1[tRNA (m2(2)G26) methyltransferase] has a novel recognition mechanism of the substrate RNA. |
Aquifex aeolicus tRNA (N2,N2-guanine)-dimethyltransferase (Trm1) catalyzes transfer of methyl groups not only to guanine 26 but also to guanine 27 in tRNA. |
Identification of Aquifex aeolicus tRNA (m2(2G26) methyltransferase gene. |
Substrate tRNA recognition mechanism of a multisite-specific tRNA methyltransferase, Aquifex aeolicus Trm1, based on the X-ray crystal structure. |