Modomics - A Database of RNA Modifications

ID Card:

Full name: Dimethyladenosine transferase 1
UniProt: Q8JZM0
Structures: | 4GC5 | 4GC9 |
Enzyme type:
Position of modification - modification: :1006(None) - m6A
:1006(None) - m6,6A
:1007(None) - m6A
:1007(None) - m6,6A
Level of experimental evidence: 2
Level of experimental reliability: 2


PDB Structures:


4GC5

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:



Download RCSB-PDB Structures:

Pdb Files   4GC5.pdb   4GC9.pdb  
Pdbx/mmCIF Files   4GC5.cif   4GC9.cif  


Protein sequence:

MAASGKLGTFRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTYKIEKAFPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEVAERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQPFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFTYNFREELKQKKSKGQEKDGDPESCGF

Comments:

Mitochondrial methyltransferase which uses S-adenosyl methionine to dimethylate two highly conserved adjacent adenosine residues (A1006 and A1007) within the loop of helix 45 at the 3-prime end of 12S rRNA, thereby regulating the assembly or stability of the small subunit of the mitochondrial ribosome




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
A:m6A rRNA (r) rRNA/rRNA/eukaryotic mitochondria 1006
m6A:m6,6A rRNA (r) rRNA/rRNA/eukaryotic mitochondria 1006
A:m6A rRNA (r) rRNA/rRNA/eukaryotic mitochondria 1007
m6A:m6,6A rRNA (r) rRNA/rRNA/eukaryotic mitochondria 1007



Publications:

Title Authors Journal Details PubMed Id DOI
Methylation of 12S rRNA is necessary for in vivo stability of the small subunit of the mammalian mitochondrial ribosome. Metodiev MD, Lesko N, Park CB, Cámara Y, Shi Y, Wibom R, Hultenby K, Gustafsson CM, Larsson NG Cell Metab. [details] 19356719 10.1016/j.cmet.2009.03.001
Structural basis for S-adenosylmethionine binding and methyltransferase activity by mitochondrial transcription factor B1. Guja KE; Venkataraman K; Yakubovskaya E; Shi H; Mejia E; Hambardjieva E; Karzai AW; Garcia-Diaz M Nucleic Acids Res [details] 23804760 10.1093/nar/gkt547