ID Card:
| Full name: |
18S rRNA (guanine-N(7))-methyltransferase |
| UniProt: |
Q18257 |
| Enzyme type: |
|
| Position of modification - modification: |
:1531(None) - m7G
|
| Level of experimental evidence: |
2 |
| Level of experimental reliability: |
2 |
Protein sequence:
MASFKVKPEHTGPPDLYYNETEAAKYASNSHITAIQHEMAERALELLALPEGKSGFLLDIGCGTGMSSEVILDAGHMFVGVDVSRPMLEIARQDEDLESGDFIHQDMGLGMPFRPGSFDGAISISAIQWLCHANASDENPRKRLLFFFQSLYGCLGRGSRAVFQFYPENDEQCDLIMGQAHKAGFNGGLVVDFPEAAKRKKVYLVLMTGGVVQLPQALTEDGEESRTQIDNAGRRFVWNSRKNEKVAKGSKAWIEAKRQRQIKQGRDVRHESKYSGRKRKTKF
Comments:
Bud23 is the methyltransferase required for N7 methylation of guanosine 1531 on the 18S rRNA. Together with DIMT1 (m6,6A s:1735, 1736)those modifications are involved in the inheritance of non-genetic information by altering ribosome heterogeneity rather than through eliciting a general defect in ribosome biogenesis.
| Reaction |
Substrate |
SubstrateType |
Position |
(Anti)Codon |
Modified (Anti)Codon |
Amino Acid Change |
Transcript Name |
Transcript Region |
Cellular Localization |
References |
|
G:m7G
|
rRNA (r) |
rRNA/rRNA/eukaryotic cytosol |
1531 |
|
|
|
|
|
|
|
Publications:
| Title |
Authors |
Journal |
Details |
PubMed Id |
DOI |
| 18S rRNA methyltransferases DIMT1 and BUD23 drive intergenerational hormesis. |
Liberman N; Rothi MH; Gerashchenko MV; Zorbas C; Boulias K; MacWhinnie FG; Ying AK; Flood Taylor A; Al Haddad J; Shibuya H; Roach L; Dong A; Dellacona S; Lafontaine DLJ; Gladyshev VN; Greer EL |
Mol Cell |
[details]
|
37689068
|
10.1016/j.molcel.2023.08.014
|