Title: | Crystal Structure of a Variant Human Activation-induced Deoxycytidine Deaminase as an MBP fusion protein |
---|---|
Classification: | HYDROLASE |
Technique: | X-Ray Diffraction |
Resolution: | 2.81 |
R value free: | 0.232 |
R value observed: | 0.185 |
R value work: | 0.183 |
Pdb Files | 5JJ4.pdb 5W0R.pdb 5W0U.pdb 5W0Z.pdb 5W1C.pdb |
Pdbx/mmCIF Files | 5JJ4.cif 5W0R.cif 5W0U.cif 5W0Z.cif 5W1C.cif |
MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMTFKENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL
Activation Induced cytidine Deaminase belongs to the mammalian enzyme family known as the "activation-induced deaminase/apolipoprotein B-mRNA-editing enzyme catalytic polypeptide like" (AID/APOBEC) protein family. AID/APOBEC share three major common elements, ultimately displaying a conserved protein architecture (Pecori et al. 2022 ).
They comprise the catalytic domain that contains an enzymatic pocket that partially overlpas with the substrate binding surface (Pecori et al. 2022 ).
Some of these enzymes have a cofactor interacting region and certain sequene elements that define their subcellular localization (Pecori et al. 2022 ).AID can both deaminate RNA and ssDNA, as well. However, no RNA modification has been observed so far. AID expression (Pecori et al. 2022 ). AID expression is regulated both transcriptionally and post-transcriptionally.
MicroRNAs (miR-155, miR-181b, miR-361, and miR-93) have a major role in AID suppression, targeting 3'-UTR (Takai et al. 2015).
AID preferentially deaminates DNA cytidine in the 5'-WRC-3' sequence context (W=dA/dT, R=dC/dG). AID catalyzes deamination within variable antibody region V(D)J gene segments of Immunoglobuline (Ig) genes in B cells, leading to somatic hypermutations (SHM). It also targets repetitive 'switch' regions leading to class switch recombination (Takai et al. 2015).
Post-translational modifications are essential for AID activity to be performed. Phosphorylation is indeed important for modulating AID's activity in B cells, where AID is phosphorylated on serine 38 (Ser38) (Takai et al. 2015).
Enter the variants
Position
Original
Variant
Alpha Fold Pdb Files | AF-Q9GZX7-F1.pdb |
Alpha Fold Pdbx/mmCIF Files | AF-Q9GZX7-F1.cif |
DSSP Secondary Structures | Q9GZX7.dssp |