Full name: | NAD-capped RNA hydrolase NudC |
---|---|
GI: | 1036413219 |
UniProt: | P32664 |
Structures: | | 1VK6 | 2GB5 | 5ISY | 5IW4 | 5IW5 | 7E44 | |
Alpha Fold Predicted Structure: | AF-P32664-F1 |
Enzyme type: | hydrolase |
Title: | |
---|---|
Classification: | |
Technique: | |
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQRRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE
mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA. Has preference for mRNAs with a 5'-end purine.
Alpha Fold Pdb Files | AF-P32664-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-P32664-F1.cif   |
DSSP Secondary Structures | P32664.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Extensive 5'-surveillance guards against non-canonical NAD-caps of nuclear mRNAs in yeast. | Yaqing Zhang,David Kuster,Tobias Schmidt,Daniel Kirrmaier,Gabriele Nübel,David Ibberson,Vladimir Benes,Hans Hombauer,Michael Knop,Andres Jäschke | Nat Commun | [details] | 33139726 | - |
"NAD-capQ" detection and quantitation of NAD caps. | Ewa Grudzien-Nogalska,Jeremy G Bird,Bryce E Nickels,Megerditch Kiledjian | RNA | [details] | 30045887 | - |
Identification of a quality-control mechanism for mRNA 5'-end capping. | Xinfu Jiao,Song Xiang,Chanseok Oh,Charles E Martin,Liang Tong,Megerditch Kiledjian | Nature | [details] | 20802481 | - |