Full name: | EKC/KEOPS complex subunit GON7 |
---|---|
Synonym: | 14q32.12 |
GI: | 212276431 |
UniProt: | Q9BXV9 |
Structures: | | 6GWJ | |
Alpha Fold Predicted Structure: | AF-Q9BXV9-F1 |
Title: | |
---|---|
Classification: | |
Technique: | |
Pdb Files | 6GWJ.pdb   |
Pdbx/mmCIF Files | 6GWJ.cif   |
MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS
Alpha Fold Pdb Files | AF-Q9BXV9-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-Q9BXV9-F1.cif   |
DSSP Secondary Structures | Q9BXV9.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Proteomic analysis of the human KEOPS complex identifies C14ORF142 as a core subunit homologous to yeast Gon7. | Wan LC, Maisonneuve P, Szilard RK, Lambert JP, Ng TF, Manczyk N, Huang H, Laister R, Caudy AA, Gingras AC, Durocher D, Sicheri F... | Nucleic Acids Res | [details] | 27903914 | - |
The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME. | Costessi A, Mahrour N, Sharma V, Stunnenberg R, Stoel MA, Tijchon E, Conaway JW, Conaway RC, Stunnenberg HG... | PLoS One | [details] | 22912744 | - |