Full name: | ubiquitin related modifier 1 |
---|---|
Synonym: | MGC2668 |
GI: | 81605 |
UniProt: | Q9BTM9 |
Alpha Fold Predicted Structure: | AF-Q9BTM9-F1 |
Enzyme type: |
MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG
Alpha Fold Pdb Files | AF-Q9BTM9-F1.pdb   |
Alpha Fold Pdbx/mmCIF Files | AF-Q9BTM9-F1.cif   |
DSSP Secondary Structures | Q9BTM9.dssp   |
Title | Authors | Journal | Details | ||
---|---|---|---|---|---|
Solution structure of Urm1 and its implications for the origin of protein modifiers. | Xu J, Zhang J, Wang L, Zhou J, Huang H, Wu J, Zhong Y, Shi Y... | Proc Natl Acad Sci U S A | [details] | 16864801 | - |