| Full name: | S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase |
|---|---|
| Synonym: | Tyw1 |
| GI: | 14520684 |
| Orf: | PAB2039 |
| COG: | COG0731 |
| UniProt: | Q9V1F9 |
| Alpha Fold Predicted Structure: | AF-Q9V1F9-F1 |
| Enzyme type: | oxidoreductase |
| Position of modification - modification: |
t:37 - mimG |
MREMITIKPGKITVQANPNMPEEVANLFRKQHYEIVGRHSGVKLCHWLKKSLTEGRFCYKQKFYGIHSHRCLQMTPVLAWCTHNCIFCWRPMETFLGTELPQPWDDPEFIVEESIKAQRKLLIGYKGNPKVDKKKFEEAWEPKHAAISLSGEPMLYPYMGDLVEEFHKRGFTTFIVTNGTVPERLEEMIKEDKLPTQLYVSITAPDIETYNSVNIPMIPDGWERIMRFLELMRDLPTRTVVRLTLVKGENMHSPEKYAKLILKARPMFVEAKAYMFVGYSRNRLTINNMPSHQDIREFAEALVKHLPGYHIEDEYEPSRVVLIMRDDVDPQGTGVNGRFIKH
Homolog of yeast Tyw1. Does not have the N-terminal FMN binding/flavodoxin domain found in Tyw1.
| Reaction | Substrate | SubstrateType | Position | (Anti)Codon | Modified (Anti)Codon | Amino Acid Change | Transcript Name | Transcript Region | Cellular Localization | References |
|---|---|---|---|---|---|---|---|---|---|---|
| m1G:imG-14 | tRNA (t) | Phe/GAA/prokaryotic cytosol | 37 | 23043105    |
| Alpha Fold Pdb Files | AF-Q9V1F9-F1.pdb   |
| Alpha Fold Pdbx/mmCIF Files | AF-Q9V1F9-F1.cif   |
| DSSP Secondary Structures | Q9V1F9.dssp   |
| Title | Authors | Journal | Details | ||
|---|---|---|---|---|---|
| 4-Demethylwyosine synthase from Pyrococcus abyssi is a radical-S-adenosyl-L-methionine enzyme with an additional [4Fe-4S](+2) cluster that interacts with the pyruvate co-substrate. | Perche-Letuvee P, Kathirvelu V, Berggren G, Clemancey M, Latour JM, Maurel V, Douki T, Armengaud J, Mulliez E, Fontecave M, Garcia-Serres R, Gambarelli S, Atta M... | J Biol Chem | [details] | 23043105 | - |