Modomics - A Database of RNA Modifications

ID Card:

Full name: Multifunctional methyltransferase subunit TRM112
GI: 1730682
Orf: YNR046W
COG: COG2835
UniProt: P53738
Structures: | 5CM2 |


PDB Structures:


5CM2

Structure Description:

Title:
Classification:
Technique:

Abstract of the PDB Structure's related Publication:

Most of the factors involved in translation (tRNA, rRNA and proteins) are subject to post-transcriptional and post-translational modifications, which participate in the fine-tuning and tight control of ribosome and protein synthesis processes. In eukaryotes, Trm112 acts as an obligate activating platform for at least four methyltransferases (MTase) involved in the modification of 18S rRNA (Bud23), tRNA (Trm9 and Trm11) and translation termination factor eRF1 (Mtq2). Trm112 is then at a nexus between ribosome synthesis and function. Here, we present a structure-function analysis of the Trm9-Trm112 complex, which is involved in the 5-methoxycarbonylmethyluridine (mcm(5)U) modification of the tRNA anticodon wobble position and hence promotes translational fidelity. We also compare the known crystal structures of various Trm112-MTase complexes, highlighting the structural plasticity allowing Trm112 to interact through a very similar mode with its MTase partners, although those share less than 20% sequence identity.

Download RCSB-PDB Structures:

Pdb Files   5CM2.pdb  
Pdbx/mmCIF Files   5CM2.cif  


Protein sequence:

MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV

Comments:

Trm112p makes complexes with Ttm11p, Trm9p and Mtq2c.







Publications:

Title Authors Journal Details PubMed Id DOI
Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA. Purushothaman SK, Bujnicki JM, Grosjean H, Lapeyre B Mol Cell Biol [details] 15899842 -
Unexpected accumulation of ncm(5)U and ncm(5)S(2) (U) in a trm9 mutant suggests an additional step in the synthesis of mcm(5)U and mcm(5)S(2)U. Chen C, Huang B, Anderson JT, Bystrom AS PLoS One [details] 21687733 -
Trm112p is a 15-kDa zinc finger protein essential for the activity of two tRNA and one protein methyltransferases in yeast. Mazauric MH, Dirick L, Purushothaman SK, Bjork GR, Lapeyre B J Biol Chem [details] 20400505 -
Trm112 Is Required for Bud23-Mediated Methylation of the 18S rRNA at Position G1575. Figaro S, Wacheul L, Schillewaert S, Graille M, Huvelle E, Mongeard R, Zorbas C, Lafontaine DL, Heurgue-Hamard V Mol Cell Biol [details] 22493060 -
The methyltransferase adaptor protein Trm112 is involved in biogenesis of both ribosomal subunits. Sardana R, Johnson AW... Mol Biol Cell [details] 22956767 -
Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes. Letoquart J, Huvelle E, Wacheul L, Bourgeois G, Zorbas C, Graille M, Heurgue-Hamard V, Lafontaine DL... Proc Natl Acad Sci U S A [details] 25489090 -
Insights into molecular plasticity in protein complexes from Trm9-Trm112 tRNA modifying enzyme crystal structure. Letoquart J, Tran NV, Caroline V, Aleksandrov A, Lazar N, van Tilbeurgh H, Liger D, Graille M... Nucleic Acids Res [details] 26438534 -